<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CAS_42_1_6375 CAS_42_1_6375 Germany 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G16E, K20M, M36I, R41K, H69K, L89I  
>CAS_42_1_6375| codons 1-99
PQITLWQRPLVTVRIEGQLMEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, K49R, I50V, V60I, D123E, I135V, S162A, E169Q, K173T, Q174E, D177E, T200A, Q207G, V245Q E40DN, T216TI
>CAS_42_1_6375| codons 15-254
GMDGPKVKQWPLTEEKIKALTDICTNMEKEGKISRVGPENPYNTPIFAIKKKDSTKWRKL
VDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPS
VNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILQPFRTENPEIVIYQYMDDLYVGSDLE
IGQHRAKIEELRGHLLRWGFTIPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEKDSWTV

References
Author Title Citation
Brown, AE Phylogenetic reconstruction of transmission events from individuals with acute HIV infection J Infect Dis, 2009