<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CAS_108_1_7868 CAS_108_1_7868 France 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, K20R, E35D, M36I, R41K, K45R, R57K, L63T, H69K, A71T, I72IT, L89M, I93L  
>CAS_108_1_7868| codons 1-99
PQITLWQRPIVTVKIEGQLREALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QITIEICGKKTTGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39M, V60I, K122E, D123N, I135T, K173L, Q174K, D177E, V179I, Q207A, R211S, V245R, D250E P1F, Q23QP
>CAS_108_1_7868| codons 1-255
FISPIETVPVKLKPGMDGPKVKPWPLTEEKIKALTEICMEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIII
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIRLPEKESWTVN

References
Author Title Citation
Brown, AE Phylogenetic reconstruction of transmission events from individuals with acute HIV infection J Infect Dis, 2009