<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BE5 BE5 Belgium 1999 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E36D, T39A, S68G, K102E, I135V, K154E, S162A, K173A, Q174K, D177E, I178M, T200A, Q207G, V245Q, E248D W153M, K220KHNQ, Q258R
>BE5| codons 1-259
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVDICAEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKEKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGMEGSPAIFQASMTKILEPFRAKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRGHLLRWGFTTPDKQHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIRK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G16E, K20I, M36I, R41K, H69K, L89M  
>BE5| codons 1-99
PQITLWQRPLVTVRIEGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Snoeck, J Prevalence and origin of HIV-1 group M subtypes among patients attending a Belgian hospital in 1999. Virus Res, 2002