<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CAS_1341_4_1244 CAS_1341_4_1244 Italy 1998 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, R41K, R57K, Q61N, V77I, I93L  
>CAS_1341_4_1244| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NILIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K49R, V60I, I135V, E138A, S162C, E169D, K173T, Q174K, D177G, Q207D, R211K, V245Q, E248N, A272P, E291D, V292I, I293V  
>CAS_1341_4_1244| codons 1-293
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRTKNPGIVI
YQYMDDLYVGSDLEIGQHRTKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIV

References
Author Title Citation
Brown, AE Phylogenetic reconstruction of transmission events from individuals with acute HIV infection J Infect Dis, 2009