<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CAS_111_1_7597 CAS_111_1_7597 France 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, E35D, M36I, N37T, I62V, L63P, T74S  
>CAS_111_1_7597| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDITLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGSVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       V8L, K20R, K122E, S162C, I178L, R211K, L228F P9N, V10F
>CAS_111_1_7597| codons 7-244
TLNFKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKK
DSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRK
YTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVIYQYMDD
LYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFFWMGYELHPDKWTVQPI

References
Author Title Citation
Brown, AE Phylogenetic reconstruction of transmission events from individuals with acute HIV infection J Infect Dis, 2009