<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BE2 BE2 Belgium 1999 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT 12
2 DDI 32
3 3TC+ D4T+ IDV 28
4 D4T+ RTV+ SQV+ 3TC 9
5 D4T+ NVP+ RTV+ 3TC 5
6 3TC+ SQV+ RTV+ D4T 18
7 3TC+ SQV+ RTV 29
8 EFV+ ABC+ NFV+ 3TC 4
9 ABC+ 3TC+ NFV+ NVP 6
10 3TC+ NFV+ ABC 10

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, L74I, M184V, T215F K219Q K103N   V35T, T39N, D123E, I135T, D177E, T200A, Q207E, R211K, V245E  
>BE2| codons 1-259
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, G48V, I54V, V82AT F53FL, L89V L10V, I13V, L19IT, K20I, M36I, R41K, K55H, L63P, C67S, H69R, A71IV  
>BE2| codons 1-99
PQITLWQRPVVTVKIGGQIIEALLDTGADDTILEEINLPGKWKPKMVVGIGGLVHVRQYD
QIPIEISGRKIIGTVLVGPTPANIIGRNVLTQIGCTLNF

References
Author Title Citation
Snoeck, J Prevalence and origin of HIV-1 group M subtypes among patients attending a Belgian hospital in 1999. Virus Res, 2002