<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CAS_373_3_1664 CAS_373_3_1664 Germany 1999 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12K, I13A, K20I, M36I, R41K, H69K, V82I, L89M  
>CAS_373_3_1664| codons 1-99
PQITLWQRPLVKAKIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35I, I135L, S162A, T165I, K173T, Q174K, D177E, I178M, Q207E, V245Q, E248V, T286A, E291D, V292I, I293V  
>CAS_373_3_1664| codons 1-293
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQASMIKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPVKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIV

References
Author Title Citation
Brown, AE Phylogenetic reconstruction of transmission events from individuals with acute HIV infection J Infect Dis, 2009