<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1161 CA23194 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 156
2 AZT+ DDC 52
3 AZT+ DDI 52
4 D4T+ DDI 52
5 AZT+ DDC 52
6 3TC+ AZT+ DDC 43
7 3TC+ AZT+ D4T+ SQV 17
8 3TC+ AZT+ D4T+ RTV+ SQV 26
9 3TC+ AZT+ D4T+ DLV+ IDV 25
10 3TC+ D4T+ NFV 26
11 D4T+ DDI 30
12 D4T+ DDI+ EFV+ ADV 26
13 ABC+ RTV+ SQV 8
14 APV+ ABC 43
15 LPV+ ABC+ D4T+ DDI 109

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, I84V, L90M L33F, K43T, F53L, T74P E34Q, M36L, I62V, L63A, A71V, I93L  
>CA23194| codons 15-99
IGGQLKEALLDTGADDTIFQELNLPGRWTPKIVGGIGGLLKVRQYDQVAIEICGHKVIGP
VLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67~, K70R, L74I, T215F T69G, K219Q L100LI, K103N   E6D, K20R, T39N, K43E, K101X, K102R, D123E, K166R, D177E, V179I, G196K, T200I, Q207E, V245K, A272P, K277R, I293V P157A
>CA23195| codons 1-301
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALVEICNELEEEGKISKIGPENPYNTPV
FAIKKK~SGRWRKIVDFRELNKRTQDFWEVQLGIPHPAGIXRNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSAAIFQSSMTRILEPFRKQNPEIII
YQYMDDLYVGSDLEIKQHRIKIEELREHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005