<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CAS_164_1_8084 CAS_164_1_8084 France 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I I15V, N37D, P39PS, L63P, A71T, I72M  
>CAS_164_1_8084| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVIEEMDLSGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTMGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K49R, I50V, D123E, I135T, I180V, R211K, F214L  
>CAS_164_1_8084| codons 31-231
IKALVEICTEMEKEGKISRVGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEV
QLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLP
QGWKGSPAIFQSSMTKILEPFRKQNPDIVVYQYMDDLYVGSDLEIGQHRTKIEELRQHLL
KWGLTTPDKKHQKEPPFLWMG

References
Author Title Citation
Brown, AE Phylogenetic reconstruction of transmission events from individuals with acute HIV infection J Infect Dis, 2009