<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1834 CA23190 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 109
2 D4T+DDI+RTV 19
3 D4T+DDC+NFV+RTV 31
4 D4T+NFV+RTV 10
5 D4T+IDV+NFV+RTV 20
6 D4T+NFV 14
7 3TC+D4T+EFV+NFV 32
8 ABC+APV+D4T 63
9 D4T+IDV+NVP+RTV 27
10 AZT+DDI+LPV 41

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, M184I, L210W   K101P, K103S   V60I, D123E, I135T, I178M, T200A, Q207E, R211K, P294Q  
>CA23190| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPKSKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYIDDLYVGSDLEIGQHRAKIEELREHLWKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIQLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L76V, L90M L33F, Q58E R57K, L63P, A71V, I93L  
>CA23191| codons 13-99
IKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKMIGGIGGFIKVKEYDQIPIEICGHKVI
GTVVVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005