<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5617 CA23188 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 70
2 3TC+AZT+IDV 105
3 3TC+D4T+IDV 118
4 APV+D4T+EFV 38
5 ABC+EFV+LPV 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y   K101E, Y181C, G190S   E6K, K43N, V106VI, V118I, K122E, I135V, V179I, V189VI, T200A, E203D, R211K, L228H  
>CA23188| codons 1-300
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSITVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYMDDLYISSDLEIGQHRAKIDELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, L90M Q58QE L10I, I13V, K20I, E35D, M36I, I62V, L63P, I64V, A71V, I72V, I93L  
>CA23189| codons 1-99
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEDINLPGRWKPKIIGGIGGFVKVREYD
QVPVEICGHKVVGTVVVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005