<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4773 CA23186 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV NA
2 DDI+EFV+NFV 56
3 APV+D4T+EFV+RTV 101

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74V, T215F K219Q K103KN, Y181C, G190A   K20R, T69N, A98S, K101KQ, K102Q, V118I, I135T, K166R, T200A, H208Y, R211K, F214L, K223Q, L228H, A272S, T286A, I293V  
>CA23186| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKVVDFRELNKRTQDFWEVQLGIPHPSGLQQNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
CQYMDDLYVASDLEIGQHRAKIEELRQYLLKWGLFTPDQKHQQEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I54L, I84V, L90M L33F, Q58E, G73S L10I, I13V, E35G, M36I, N37D, D60E, Q61E, I62V, L63P, I66V, H69Y, A71V, I72K, P79S  
>CA23187| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTIFEGIDLPGRWKPKMIGGIGGFLKVREYE
EVPIEVCGYKVKSTVLVGSTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005