<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CAS_749_16_33349 CAS_749_16_33349 France 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   T12P, K14R, L19I, E35D, N37E, K43R, L63A, A71T, V77I, I93L  
>CAS_749_16_33349| codons 1-99
PQITLWQRPLVPIRIGGQIKEALLDTGADDTVLEDMELPGRWRPKMIGGIGGFIKVRQYD
QIAIEICGHKTIGTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V60I, D123E, E169D, I178L, T200A, E203D, R211K, K277R, A288S, I293V  
>CAS_749_16_33349| codons 1-293
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRAKIDELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKSLTEVV

References
Author Title Citation
Brown, AE Phylogenetic reconstruction of transmission events from individuals with acute HIV infection J Infect Dis, 2009