<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CAS_11_1_5767 CAS_11_1_5767 France 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, M36L, R41K, R57K, I62V, A71T, I93L G40GR
>CAS_11_1_5767| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEELNLPRKWKPKMIGGIGGFIKVKQYD
QVLIEICGHKTIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K32N, V35I, S68G, K122E, I135R, A158S, G196E, R211G I37IM, T216TI, W239WC, Q242Q*HY
>CAS_11_1_5767| codons 14-244
PGMDGPKVKQWPLTEEKINALIEMCTEMEKEGKISKIGPENPYNTPVFAIKKKDGTKWRK
LVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIP
SRNNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDL
EIEQHRTKIEELRQHLLGWGFTIPDKKHQKEPPFLWMGYELHPDKCTVYPI

References
Author Title Citation
Brown, AE Phylogenetic reconstruction of transmission events from individuals with acute HIV infection J Infect Dis, 2009