<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8026 CA23178 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ NFV 174
2 DDI+EFV+RTV+SQV 46

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74V, M184V T215TS L100I, K103N   K46Q, I135M, S162Y, E169D, T200A, Q207K, R211X, V245E, A272P, V292I, I293V  
>CA23178| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGQISKIGPENPYNTPV
FAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLXWGFSTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEIVPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   L10X, K20IR, E35D, M36I, N37S, R41K, D60E, I62V, L63P, I64V, A71V, P79A, I93L  
>CA23179| codons 1-99
PQITLWQRPXVTIKIGGQLIEALLDTGADDTVLEDISLPGKWKPKMIGGIGGFIKVRQYE
QVPVEICGHKVIGTVLVGATPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005