<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PE2-0087 PE2-0087 Brazil 2009 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, I13V, K14R, I15V, K20M, E35D, M36I, P39Q, R57K, D60E, Q61D, L63P, L89M  
>PE2-0087| codons 1-99
PQITLWQRPLVAVRVGGQLMEALLDTGADDTVLEDINLQGRWKPKMIGGIGGFIKVKQYE
DIPIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, T39G, D123E, I135T, S162C, K173A, Q174K, D177N, Q197P, T200A, Q207N, R211K, V245Q, E248D K30R
>PE2-0087| codons 1-254
PISPIETVPVKLKPGMDGPRVKQWPLTEERIKALTEICGEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPNIVI
YQYMDDLYVGSDLEIGPHRAKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTV

References
Author Title Citation
Alencar, C HIV genotypes and primary drug resistance among HIV seropositive blood donors in Brazil: Role of infected blood donors as sentinel populations for molecular surveillance of HIV. JAIDS, 2013