<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RJ2-0095 RJ2-0095 Brazil 2009 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, N37D, R41K, L63P, I64L, A71V, I72E, V77I, I93L  
>RJ2-0095| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYDQIP
LEICGHKVEGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20KR, V35T, K49R, V60I, D121Y, K122E, D123E, I135T, T165I, E169D, D177E, T200I, R211K  
>RJ2-0095| codons 1-217
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRIKIEELRQHLLKWGFTTP

References
Author Title Citation
Alencar, C HIV genotypes and primary drug resistance among HIV seropositive blood donors in Brazil: Role of infected blood donors as sentinel populations for molecular surveillance of HIV. JAIDS, 2013