<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5541 CA23177 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+ DDI 156
3 AZT+ 3TC 104
4 3TC+ DDI+ IDV 25
5 DDI+ RTV+ NFV 17
6 3TC+ D4T+ NVP 30
7 DDI+ RTV+ SQV 43
8 None 61
9 APV+ RTV+ ABC+ NVP 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, V82A L33LF I15V, N37S, L63LP, A71V  
>CA23177| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTIFEEMSLPGRWKPKIVGGIGGFMKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69T_N, K70R, L74V D67G, K219Q K103N, Y181C   K20R, V35I, K64N, K122P, S134SN, F214L, D218E, D250E, K277R, R284K, T286A, I293V, E297A, I326V, Q334D, G335S, R356K, R358K, K366R, K390R, A400T, L452S, V458I, D460N, L469F, Q524E, K558R S68Y, P345PR
>CA23176| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAINKKGYTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPNINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLKGAKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGDSQWTYQIYQERFKNLKTGKYAKMKGA
HTNDVRQLTEAVQKIATESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKSGKAGYITNRGRQKVVSFTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEELIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRRVL

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005