<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RJ2-0105 RJ2-0105 Brazil 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, L19T, M36L, N37S  
>RJ2-0105| codons 1-99
PQITLWQRPLVTIRVGGQTKEALLDTGADDTVLEELSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L T215C   A98G K11KR, T39A, S68G, K103R, K122V, S162D, T200I, R211K, F214L, V245M  
>RJ2-0105| codons 1-252
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKRKSVTVLDVGDAYFSVPL
DVDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRIKIEELRQHLLKWGLCTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSW

References
Author Title Citation
Alencar, C HIV genotypes and primary drug resistance among HIV seropositive blood donors in Brazil: Role of infected blood donors as sentinel populations for molecular surveillance of HIV. JAIDS, 2013