<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MG2-0040 MG2-0040 Brazil 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, G16E, M36I, N37K, P39S, R41N, L63V, H69K, T74A, L89M, I93L  
>MG2-0040| codons 4-99
TLWQRPVVTIKVEGQLKEALLDTGADDTVLEEIKLSGNWKPKMIGGIGGFIKVRQYDQIV
IEICGKKAIGAVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K32R, V35T, E36A, T39E, E40D, S48T, D121H, K122E, D123S, I135R, S162A, K173T, D177E, T200A, I202V, Q207E, R211K  
>MG2-0040| codons 1-238
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALTAICEDMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTQNPEIVI
YQYMDDLYVGSDLEIGQHRAKVEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Alencar, C HIV genotypes and primary drug resistance among HIV seropositive blood donors in Brazil: Role of infected blood donors as sentinel populations for molecular surveillance of HIV. JAIDS, 2013