<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PE2-0094 PE2-0094 Brazil 2009 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, K20R, E35D, M36I, P39A, R41K, Q61N, L63Q, L89M  
>PE2-0094| codons 1-99
PQITLWQRPLVTIKVGGQLREALLDTGADDTVLEDINLAGKWKPKMIGGIGGFIKVRQYD
NIQIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35K, K102Q, K104R, D123E, I132V, I135V, S162Y, K173T, Q174K, D177E  
>PE2-0094| codons 1-206
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTVPSVNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELR

References
Author Title Citation
Alencar, C HIV genotypes and primary drug resistance among HIV seropositive blood donors in Brazil: Role of infected blood donors as sentinel populations for molecular surveillance of HIV. JAIDS, 2013