<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP2-0068 SP2-0068 Brazil 2009 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12I, I13V, I15V, E35D, M36I, N37D, R41K, R57K, Q61N, L63CS, I72IT  
>SP2-0068| codons 5-99
LWQRPVVIVKVGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQYDNISI
EICGHKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215E     E6K, K20R, V35K, V60I, S68N, V118I, K122E, I135T, S162A, T165I, K173R, Q174K, V189I, G196GE, Q207E, R211K, F214L  
>SP2-0068| codons 1-234
PISPIKTVPVKLKPGMDGPRVKQWPLTEEKIKALKEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDNTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMIKILEPFRRKNPDIVI
YQYMDDLYIGSDLEIEQHRTKIEELREHLLKWGLETPDKKHQKEPPFLWMGYEL

References
Author Title Citation
Alencar, C HIV genotypes and primary drug resistance among HIV seropositive blood donors in Brazil: Role of infected blood donors as sentinel populations for molecular surveillance of HIV. JAIDS, 2013