<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4374 CA23173 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 83
2 D4T+NFV+NVP 30
3 3TC+AZT+SQV 22
4 None 48
5 D4T+EFV+IDV+RTV 100

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, V82A, L90M   I13V, K43S, L63P, A71AV, I93L  
>CA23173| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTILEEMNLPGRWSPKIVGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215CY K219E K103N, Y181C V108I P4S, V60I, V90I, D123E, S162D, V179I, I195L, R211T, L228H, A272P, K281R, T286A, E297K  
>CA23172| codons 1-300
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIII
CQYMDDLYVGSDLELGQHRTKIEELRQHLLTWGFCTPDEKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTEVIPLTKEAE

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005