<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1251 CA23171 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+DDC 26
3 AZT+DDI 65
4 3TC+AZT+D4T 39
5 3TC+D4T+DDI 17
6 3TC+D4T+DDI+SQV 13
7 3TC+RTV+SQV 17
8 3TC+NVP 26
9 3TC+AZT+IDV 8
10 3TC+D4T+RTV+SQV 9
11 3TC+D4T+NVP+RTV+SQV 87
12 3TC+ABC+NVP+RTV+SQV 30
13 Unknown 115

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I84V, L90M L10F, L33I, N88D I13V, E35D, M36I, R41K, L63P, I66V, A71V  
>CA23171| codons 1-99
PQITLWQRPFVTVKIGGQLKEALLDTGADDTIIEDINLPGKWKPKIVGGIGGFIKVRQYD
QIPIEVCGHKVIGTVLVGPTPVNVIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215F K219E Y188L   V35I, V60I, T69N, V118I, K122E, V179I, H208Y, K223E, L228H, V245R, A272P, K277R, I293V L303P
>CA23170| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLLVGSDLEIGQHRTKIEELRQYLLRWGFFTPDEKHQEEPPFHWMGYELHPDKWT
VQPIRLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
LEP

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005