<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PE2-0091 PE2-0091 Brazil 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, M36L, R41K, D60E, L63P, I64V  
>PE2-0091| codons 5-99
LWQRPVVTVKIGGQLKEALLDTGADDTVLEELNLPGKWKPKMIGGIGGFIKVRQYEQIPV
EICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, S68G, D123E, I142A, S162A, D177E, I178L, V179I, E204N, Q207D, R211K, F214L  
>PE2-0091| codons 1-229
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGARYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPELII
YQYMDDLYVGSDLEIGQHRTKIENLRDHLLKWGLTTPDKKHQKEPPFLW

References
Author Title Citation
Alencar, C HIV genotypes and primary drug resistance among HIV seropositive blood donors in Brazil: Role of infected blood donors as sentinel populations for molecular surveillance of HIV. JAIDS, 2013