<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MG2-0036 MG2-0036 Brazil 2009 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, L19I, K20Q, M36I, R41K, K45R, R57K, I62V, L63P, I72IV, I93L  
>MG2-0036| codons 7-99
QRPVVTIKVGGQIQEALLDTGADDTVLEEINLPGKWKPRMIGGIGGFIKVKQYDQVPIEI
CGHKAVGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, T39TA, S48E, K103R, V118I, Q197K, R211K, F214L  
>MG2-0036| codons 1-233
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGKHRTKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYE

References
Author Title Citation
Alencar, C HIV genotypes and primary drug resistance among HIV seropositive blood donors in Brazil: Role of infected blood donors as sentinel populations for molecular surveillance of HIV. JAIDS, 2013