<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9431 CA23155 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 DDI+D4T+RTV+SQV+EFV 52
3 3TC+AZT+EFV+IDV+LPV 21
4 D4T+DDI+RTV+SQV 30

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, Q151M, L210W, T215Y V75I, F116Y Y181C, G190S   K43N, K101Q, V111I, V118I, K122E, I142V, K173T, G196E, T200A, E203D, H208Y, R211K, V245K, A272P, K277R, T286A, E297K  
>CA23155| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDIGDAYYSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPMGWKGSPAIFQSSMTKILEPFRTQNPDIVI
CQYMDDLYVSSDLEIEQHRAKIDELRQYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76LV, I84V, L90M F53FL L10I, I13IV, K20R, E35D, M36I, N37E, K55R, R57K, D60E, L63P, I64V, A71V, I93L  
>CA23154| codons 1-99
PQITLWQRPIVTVKIGGQLREALLDTGADDTVLEDIELPGRWKPKIIGGIGGLIRVKQYE
QIPVEICGHKVIGTVVVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005