<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RJ2-0055 RJ2-0055 Brazil 2009 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, L19I, E35D, M36I, N37E, R41K, R57K, D60E, Q61N, L63S, E65D  
>RJ2-0055| codons 1-99
PQITLWQRPLVTIRVGGQIKEALLDTGADDTVLEDIELPGKWKPKMIGGIGGFIKVKQYE
NISIDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, D123E, I135V, S162C, K173A, Q174K, D177E, R211A  
>RJ2-0055| codons 1-220
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLAWGFTTPDKK

References
Author Title Citation
Alencar, C HIV genotypes and primary drug resistance among HIV seropositive blood donors in Brazil: Role of infected blood donors as sentinel populations for molecular surveillance of HIV. JAIDS, 2013