<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9430 CA23152 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 13
2 3TC+D4T+NFV 96
3 3TC+D4T+EFV+NFV 22
4 3TC+APV+AZT 127

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I50V L33F, N88D, L89LV I13V, E34D, E35D, M36I, K43KQ, L63P, I66IF, H69Q, A71AT  
>CA23152| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVFDDINLPGRWQPKMIGGVGGFIKVRQYD
QIPIEFCGQKTIGTVLVGPTPVNIIGRDVLTQIGCTLNF

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005