Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA9430 | CA23152 | U.S. | 2001 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | DDI | 13 |
| 2 | 3TC+D4T+NFV | 96 |
| 3 | 3TC+D4T+EFV+NFV | 22 |
| 4 | 3TC+APV+AZT | 127 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| D30N, I50V | L33F, N88D, L89LV | I13V, E34D, E35D, M36I, K43KQ, L63P, I66IF, H69Q, A71AT |
| >CA23152| codons 1-99 PQITLWQRPLVTVKIGGQLKEALLDTGADNTVFDDINLPGRWQPKMIGGVGGFIKVRQYD QIPIEFCGQKTIGTVLVGPTPVNIIGRDVLTQIGCTLNF |
References
| Author | Title | Citation |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |