<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RJ2-0026 RJ2-0026 Brazil 2009 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, E35D, M36I, R41K, L63V, I64L, H69K  
>RJ2-0026| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIVLEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4T, A98S, D121C, K122E, D123E, I180V, T200A, R211K  
>RJ2-0026| codons 1-231
PISTIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
CEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVV
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLWMG

References
Author Title Citation
Alencar, C HIV genotypes and primary drug resistance among HIV seropositive blood donors in Brazil: Role of infected blood donors as sentinel populations for molecular surveillance of HIV. JAIDS, 2013