<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9428 CA23149 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI 187
2 3TC+D4T+RTV 57
3 3TC+D4T+NFV+NVP 43
4 3TC+AZT+LPV 99

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N Y181C V108I V35M, T39A, K43KQ, E44D, A98S, V118VI, I135IT, V179VI, H208Y, R211K, H221Y, A288T, I293V, E297R  
>CA23149| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTILDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYVDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDNKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKTLTEVVPLTREA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I, L33F, K43T, F53L, N83D L10I, I13V, K20R, M36I, D60E, I62V, L63P, I64V  
>CA23148| codons 1-99
PQITLWQRPIVTVKIGGQLREALIDTGADDTVFEEINLPGRWTPKMIGGIGGLVKVRQYE
QVPVEICGHKAIGTVLVGPTPADIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005