<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PE2-0053 PE2-0053 Brazil 2009 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, E35D, M36I, R41K, Q61N, L63Q, K70Q, L89M  
>PE2-0053| codons 1-99
PQITLWQRPLVTIRVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
NIQIEICGHQAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, S48T, K104R, D123E, I135V, S162C, K173I, Q174K, D177E, T200A, Q207V, R211K  
>PE2-0053| codons 1-231
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRVHLLKWGFTTPDKKHQKEPPFLWMG

References
Author Title Citation
Alencar, C HIV genotypes and primary drug resistance among HIV seropositive blood donors in Brazil: Role of infected blood donors as sentinel populations for molecular surveillance of HIV. JAIDS, 2013