<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RJ2-0044 RJ2-0044 Brazil 2009 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12N, K14R, L19I, M36I, R57K, Q61S, L63S, I64V  
>RJ2-0044| codons 1-99
PQITLWQRPLVNIRIGGQIKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVKQYD
SISVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, K49R, K104KR, I135IT, S162C, T200A, I202V, V245Q, E248D, D250E  
>RJ2-0044| codons 1-254
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKVEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTV

References
Author Title Citation
Alencar, C HIV genotypes and primary drug resistance among HIV seropositive blood donors in Brazil: Role of infected blood donors as sentinel populations for molecular surveillance of HIV. JAIDS, 2013