<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RJ2-0017 RJ2-0017 Brazil 2009 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I L19I, N37NS, R41K, L63P, A71V, V77I, Q92QE, I93L  
>RJ2-0017| codons 4-99
TLWQRPLVTIKIGGQIKEALLDTGADDTVIEEMSLPGKWKPKMIGGIGGFIKVRQYDQIP
IEICGHKVIGTVLIGPTPVNIIGRNLLTELGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6EK, E40ED, K64KR, K122E, I135IV, Q174QH, G196E, I202V, R211G, V245K  
>RJ2-0017| codons 1-249
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTDMEKEGKISKIGPENPYNTPV
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIVI
YQYMDDLYVGSDLEIEQHRTKVEELRQHLLGWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEK

References
Author Title Citation
Alencar, C HIV genotypes and primary drug resistance among HIV seropositive blood donors in Brazil: Role of infected blood donors as sentinel populations for molecular surveillance of HIV. JAIDS, 2013