<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RJ2-0053 RJ2-0053 Brazil 2009 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39A, E40D, V106VI, V118I, K122E, I135T, E138A, S162C, E169D, R172K, K173T, Q174K, I202V, Q207E, L210M, R211RK, F214L  
>RJ2-0053| codons 1-241
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFKTKNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELREHLMKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
V

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12I, I13V, I15V, G16E, E35D, M36I, P39T, R41K, D60E, I72V, L89M  
>RJ2-0053| codons 11-99
VIVKVEGQLKEALLDTGADDTVLEDINLTGKWKPKMIGGIGGFIKVRQYEQILIEICGHK
AVGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Alencar, C HIV genotypes and primary drug resistance among HIV seropositive blood donors in Brazil: Role of infected blood donors as sentinel populations for molecular surveillance of HIV. JAIDS, 2013