<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-35 TCDD-35_1 Zimbabwe 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC+NFV 65
2 3TC+AZT+IDV 18
3 3TC+AZT+NFV 14

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  G73S T12S, I15V, L19I, M36I, R41K, D60E, L63AP, H69K, V75I, I93L  
>TCDD-35_1| codons 3-94
ITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYEQI
AIEICGKKAISTILVGPTPVNIIGRNLLTQLG

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70KR, M184V, T215Y       V35T, E36A, T39E, S48T, E53D, V60I, K122E, D123S, I135V, S162C, K166R, I167IV, K173A, Q174K, D177E, I178L, T200A, Q207E, R211K, L228H  
>TCDD-35_1| codons 32-242
KALTAICEELEKEGKITKIGPDNPYNTPIFAIKKKDSTRWRKLVDFRELNKRTQDFWEVQ
LGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSVNNETPGIRYQYNVLPQ
GWKGSPAIFQCSMTRVLEPFRAKNPELVIYQYVDDLYVGSDLEIGQHRAKIEELREHLLK
WGFYTPDKKHQKEPPFHWMGYELHPDKWTVQ

References
Author Title Citation
Kantor, R HIV-1 subtype C reverse transcriptase and protease genotypes in Zimbabwean patients failing antiretroviral therapy. ARHR, 2002