Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| TCDD-32 | TCDD-32 | Zimbabwe | 2001 | HIV1 | C | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | EFV+ AZT+ 3TC | 56 |
| 2 | AZT+ 3TC+ RTV | 18 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| T12S, I13LV, K14EQ, L19I, E35D, M36I, R41K, L63V, H69K, T74S, L89M, I93L |
| >TCDD-32| codons 5-99 LWQRPLVSLEIGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIVI EICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF |
References
| Author | Title | Citation |
| Kantor, R | HIV-1 subtype C reverse transcriptase and protease genotypes in Zimbabwean patients failing antiretroviral therapy. | ARHR, 2002 |
| Johnston, E | High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. | J Virol, 2003 |