<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MG2-0010 MG2-0010 Brazil 2009 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, E35D, M36I, P39Q, R41K, K45R, R57K, Q61N, L63S, I64L  
>MG2-0010| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEDINLQGKWKPRMIGGIGGFIKVKQYD
NISLEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V8VI, V35T, E40D, K49R, V60I, D123E, I135T, I142V, E169D, K173T, Q174K, V179T, T200A, Q207K, R211Q  
>MG2-0010| codons 1-240
PISPIDTIPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILDPFRTKNPDITI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLQWGFTTPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Alencar, C HIV genotypes and primary drug resistance among HIV seropositive blood donors in Brazil: Role of infected blood donors as sentinel populations for molecular surveillance of HIV. JAIDS, 2013