<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-30 TCDD-30_1 Zimbabwe 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ NFV+ 3TC 4
2 3TC+ AZT+ IDV 10

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, T39E, S48T, E53D, K122E, D123GS, K173T, D177DE, I178IL, I195K, T200A, Q207A, R211K  
>TCDD-30_1| codons 26-243
LTEEKIKALTEICEEMEKEGKITKIGPDNPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQ
DFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQ
YNVLPQGWKGSPAIFQSSMTKILEPFRTQNPELVIYQYVDDLYVGSDLEKGQHRAKIEEL
RAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12A, I15V, L19I, E35D, M36I, N37ND, R41K, H69KQ, L89M, I93IL  
>TCDD-30_1| codons 2-99
QITLWQRPIVAIKVGGQIKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYDQ
ILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003
Kantor, R HIV-1 subtype C reverse transcriptase and protease genotypes in Zimbabwean patients failing antiretroviral therapy. ARHR, 2002
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009