Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| TCDD-29 | TCDD-29 | Zimbabwe | 2001 | HIV1 | C | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | 3TC+ SQV+ AZT | 140 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| L90M | I15V, G16E, K20KR, E21EK, E35D, M36I, P39S, R41K, K45R, D60E, L63P, H69K, A71AV, L89M, I93L, F99X |
| >TCDD-29| codons 3-99 ITLWQRPLVTIKVEGQLRKALLDTGADDTVLEDINLSGKWKPRMIGGIGGFIKVRQYEQI PIEICGKKVIGTVLVGPTPVNIIGRNMMTQLGCTLNX |
References
| Author | Title | Citation |
| Kantor, R | HIV-1 subtype C reverse transcriptase and protease genotypes in Zimbabwean patients failing antiretroviral therapy. | ARHR, 2002 |
| Johnston, E | High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. | J Virol, 2003 |
| Kassaye, S | Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. | JAIDS, 2009 |