<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-28 TCDD-28_1 Zimbabwe 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+SQV 279

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I15V, G16E, K20KR, E21EK, E35D, M36I, P39S, R41K, K45R, D60E, L63P, H69K, A71AV, L89M, I93L  
>TCDD-28_1| codons 3-98
ITLWQRPLVTIKVEGQLRKALLDTGADDTVLEDINLSGKWKPRMIGGIGGFIKVRQYEQI
PIEICGKKVIGTVLVGPTPVNIIGRNMMTQLGCTLN

References
Author Title Citation
Kantor, R HIV-1 subtype C reverse transcriptase and protease genotypes in Zimbabwean patients failing antiretroviral therapy. ARHR, 2002
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003