<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-27 TCDD-27 Zimbabwe 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 SQV+ AZT 83
2 AZT+ SQV+ 3TC 66

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I13V, I15V, G16E, L19I, K20R, M36I, R41K, H69K, I93L  
>TCDD-27| codons 3-99
ITLWQRPLVSVKVEGQIREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQI
LIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, K70KR, M184V, T215Y     A98AG V35T, E36A, T39D, S48ST, V60I, K122E, D123N, I135T, K173A, Q174K, D177E, T200A, L205LF, Q207E, R211K  
>TCDD-27| codons 27-242
TEEKIKALTAICDELEKEGKITKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQD
FWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSTNNETPGIRYQY
NVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVIYQYVDDLYVGSDLEIGQHRAKIEEFR
EHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQ

References
Author Title Citation
Kantor, R HIV-1 subtype C reverse transcriptase and protease genotypes in Zimbabwean patients failing antiretroviral therapy. ARHR, 2002
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009