<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RJ2-0015 RJ2-0015 Brazil 2009 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, I15V, Q18E, K20R, E35D, M36I, R41K, R57K, Q61N, L63I, E65D, I72T, L89M  
>RJ2-0015| codons 5-99
LWQRPVVTVKVGGELREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDNIII
DICGHKATGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39L, D123E, I135T, S162C, E169D, K173T, T200A, I202V, Q207K, R211S, F214X, K223X  
>RJ2-0015| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRTQNPDIVI
YQYMDDLYVGSDLEIGQHRAKVEELRKHLLSWGXTTPDKKHQXEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Alencar, C HIV genotypes and primary drug resistance among HIV seropositive blood donors in Brazil: Role of infected blood donors as sentinel populations for molecular surveillance of HIV. JAIDS, 2013