<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-26 TCDD-26 Zimbabwe 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 SQV+ 3TC 10
2 AZT+ 3TC 8
3 3TC+ AZT+ SQV 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19X, M36I, R41K, L63V, H69K, V82I, L89M, I93L  
>TCDD-26| codons 3-99
ITLWQRPLVTIKVGGQXKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQI
VIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, K43R, S48ST, E53ED, K122E, D123NS, K173E, D177E, I178IM, T200A, E204EK, Q207EK  
>TCDD-26| codons 26-244
LTEEKIKALTAICEEMEREGKITKIGPDNPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQ
DFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQ
YNVLPQGWKGSPAIFQSSMTKILEPFREQNPEMVIYQYMDDLYVGSDLEIGQHRAKIEKL
REHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPI

References
Author Title Citation
Kantor, R HIV-1 subtype C reverse transcriptase and protease genotypes in Zimbabwean patients failing antiretroviral therapy. ARHR, 2002
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003