<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RJ2-0009 RJ2-0009 Brazil 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, M36I, N37K, R41N, D60E, H69K, L89M, I93L  
>RJ2-0009| codons 1-99
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEEIKLPGNWKPKMIGGIGGFIKVRQYE
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39D, S48T, K122E, D123S, K173T, Q174K, D177E, T200A, Q207G, R211K, V245Q  
>RJ2-0009| codons 1-258
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQ

References
Author Title Citation
Alencar, C HIV genotypes and primary drug resistance among HIV seropositive blood donors in Brazil: Role of infected blood donors as sentinel populations for molecular surveillance of HIV. JAIDS, 2013