<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SS045098 045098 Thailand 1999 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, E35D, M36I, R41K, L63H, H69K, L89M, I93V  
>045098| codons 1-99
PQITLWQRPIVTVKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIHIEICGKKAIGTVLVGPTPVNIIGRNMLTQVGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  D67V     E6D, K11Q, V35I, T39K, K43E, T69P, K122E, D123S, K173I, Q174K, I178M, Q207A, R211S, V245E, V276I, T286A, E291D, V292I, I293V, E312T, P313L S68A, V314C
>045098| codons 1-315
PISPIDTVPVQLKPGMDGPKVKQWPLTEEKIKALIEICKEMEEEGKISKIGPENPYNTPV
FAIKKKVAPKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKIKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKTLCH

References
Author Title Citation
Sirivichayakul, S Survey of reverse transcriptase from the heterosexual epidemic of human immunodeficiency virus type 1 CRF01_AE in Thailand from 1990 to 2000. ARHR, 2001