<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP17-331966 SP17-331966 Spain 2006 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15V, K20I, M36I, N37T, P39S, R41K, L63P, H69K, L89I  
>SP17-331966| codons 1-99
PQITLWQRPLVTVRVGGQLIEALLDTGADDTVLEEITLSGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T7P, K11S, V35T, E36D, E40D, K49R, V60I, D123N, I135V, S162A, K173S, D177E, V179I, T200A  
>SP17-331966| codons 1-206
PISPIEPVPVSLKPGMDGPKVKQWPLTEEKIKALTDICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRSQNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELR

References
Author Title Citation
Holguin, A Increase of non-B subtypes and recombinants among newly diagnosed HIV-1 native Spaniards and immigrants in Spain. Curr HIV Res, 2008