<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-97422 EHR-97422 Denmark 2006 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, I15V, K20I, E35Q, M36I, R41K, R57K, C67E, H69K, V82I, L89M  
>EHR-97422| codons 1-99
PQITLWQRPIVTVRVGGQLIEALLDTGADDTVLEQINLPGKWKPKMIGGIGGFIKVKQYD
QILIEIEGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, K49R, K122E, S162C, E169T, K173T, Q174K, D177E, T200A, Q207AEG, R211RKNS, V245Q  
>EHR-97422| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILTPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRGHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013