<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-94228 EHR-94228 Romania 2007 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, L19LI, E35D, M36I, R41K, R57K, L63T, E65D, I72T, V82VI, L89M  
>EHR-94228| codons 1-99
PQITLWQRPLVTVKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QITIDICGHKATGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39A, V106VI, K122P, D123DE, I135L, I142IV, S162C, E169ED, K173E, Q174X, D177E, I178L, T200A, Q207E, V245Q  
>EHR-94228| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DPEFRKYTAFTIPSLNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILDPFREXNPELVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013