<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-86876 EHR-86876 Cyprus 2007 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LI, T12K, I15V, L19I, E35D, M36I, R41K, K43R, R57K, L63V, E65D  
>EHR-86876| codons 1-99
PQITLWQRPIVKIKVGGQIKEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVKQYD
QIVIDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20KR, V35T, T39L, K49R, K101KQ, D123E, S162C, E169D, K173A, I178L, E204Q, Q207A, P243Q, V245Q  
>EHR-86876| codons 1-247
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICLEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEQLRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQQIQLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013